Table:
begin	end	state
1	11	cytoplasmic
12	36	transmembrane
37	68	non-cytoplasmic
69	94	transmembrane
95	102	cytoplasmic
103	123	transmembrane
124	155	non-cytoplasmic
156	177	transmembrane
178	210	cytoplasmic
211	237	transmembrane
238	258	non-cytoplasmic
259	282	transmembrane
283	288	cytoplasmic

Input:
>3607561
MATKHSRSAARLMMAPAVILLLGWMLVPLTMTLLFSFKQYLPLRGGDLGWVGFDNYIRFV
SSSAFWPSVTATLIIVGGVLAITITLGVLLAILLNQPMWGQGVVRILVIAPFFVMPTVSA
LVWKNMFMDPTNGLLAHLWRFFGAEPVSWLSEASMTSIIMIVSWQWLPFATLILLTAIQS
LDSEQLEAAEMDGAPPVKRFAFITLPHLSRAITIVLLIQTIFLLAIFAEIFVTTGGAFGT
RTLTYLIFQRVLESQNVGLGSAGGVYAIILANIVAIFLMRIVGKNLDA

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server