Table:
begin	end	state
1	15	non-cytoplasmic
16	38	transmembrane
39	69	cytoplasmic
70	94	transmembrane
95	99	non-cytoplasmic
100	121	transmembrane
122	148	cytoplasmic
149	168	transmembrane
169	186	non-cytoplasmic
187	206	transmembrane
207	216	cytoplasmic
217	240	transmembrane
241	245	non-cytoplasmic
246	249	transmembrane
250	250	non-cytoplasmic
251	270	transmembrane
271	305	cytoplasmic
306	332	transmembrane
333	351	non-cytoplasmic
352	374	transmembrane
375	394	cytoplasmic
395	414	transmembrane
415	419	non-cytoplasmic
420	441	transmembrane
442	457	cytoplasmic

Input:
>5207908
MEGITEFVSTINGFVWGTPMLVMILGVGLFLSFGLRLMPILKLGTGFKLLWSGRIPDKDK
QMKGEISPFNALMTSLSATIGTGNIAGVATAIFIGGPGALFWMWCTALVGMATKFSEAVL
AVKYREVDDNGNHIGGPMYYIKNGLGSKWAWLGTAFALFGSFAGFGIGNTVQANSVADAL
NSNFGVPTWVTGLVLMVLVGAVLMGGIKRIADVAGKLVPLMTVFYIAAGLSVIVVNAAAI
PDAIALIVHSAFNPVAAQGGFAGAAVWAAVRFGVARGVFSNEAGLGSAPIAHAAAQTNNP
VAQGLVAMLGTFIDTLVVCTITGLAIVVSGAWTSGENGAALTSYAFSHALPMGNYIVAIA
LSIFAFTTILGWSVYSEKCVQYLFGVRAVKPFRAIWVIVVPLGAVSSLDFIWLLADTLNA
MMAIPNLIALSLLSPVVFGLTREYFIKKRQQEAEASS

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server