Table:
begin	end	state
1	11	cytoplasmic
12	31	transmembrane
32	42	non-cytoplasmic
43	65	transmembrane
66	73	cytoplasmic
74	96	transmembrane
97	130	non-cytoplasmic
131	148	transmembrane
149	158	cytoplasmic
159	180	transmembrane
181	201	non-cytoplasmic
202	222	transmembrane
223	236	cytoplasmic
237	259	transmembrane
260	289	non-cytoplasmic
290	312	transmembrane
313	323	cytoplasmic
324	343	transmembrane
344	348	non-cytoplasmic
349	371	transmembrane
372	382	cytoplasmic
383	402	transmembrane
403	413	non-cytoplasmic
414	433	transmembrane
434	443	cytoplasmic

Input:
>5208257
MQNNKLSMTDTLGLGFMTFAFFLGAGNLIFPPLAGFLAGENMSWAMIGFLLTAVTLPLVT
LIAVAKANGKVMGLLPPLAATMLAIAIYIIIGPAFAAPRAGLVAYEMGYKPFIQDAQASF
EVAGVVFTSSQLLYTSIFFGIAMLLSLFPGKLLDSVGKVLTPIMIILLVGLAISVVVLPG
SDVAAAVGDYQTNPLTKGIIEGYNTMDTLASLIFGMLIIDLLRKKGVDSPREQTKYLVRA
AFIAAGGLAFVYVSLFYLGATAGDLAVGADNGGVILTNYVNYQFGASGQLLLAAVVTLAC
LTTVVGLVSACAEYFNELMPSLSYKLLVVVMSVTCAVVANVGLAQLINISIPVLVTIYPV
AIALVAVTYLTERFAQPAFAHRMVLSVALVFGIIDGLKAAGVNMSMFDVMPLSAQGMAWL
IPTAITIFACLMVKRPRGEAVLN

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server