Table:
begin	end	state
1	370	non-cytoplasmic

Input:
>6939439
MSGSTELRVQIRQTKGIRIEADFSCRAGEFLAVVGPSGGGKTTLLRMIAGLAKPENGSIR
CGKRIWFDSDEGIHCSPQNRHIGFVPQHFGLFPKLSALGNIMAALDHLPSQERRPRALAA
LEKVNLHGLTDRLPSQLSGGQKQRVALARALAREPRVLLLDEPFSAVDRETRERLYLELA
RLKAELNIPVIMVTHDLNEALLLADSMLLISQGHMLQHGTPQDVFSRPRNEAVARQMGLR
NIFNAHVVAQDCAKGVTWLKFGDRLIASDSLPRVNIGDKVRWVIPNQGIRFNSIASGRLC
RSFNILPIHIDNMLTLGESVRLEASVQDSGERLNVEIPLHLAHKLALTQGAATEVALKSD
QVHILEMIKA

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server