Table:
begin	end	state
1	11	cytoplasmic
12	32	transmembrane
33	104	non-cytoplasmic
105	128	transmembrane
129	138	cytoplasmic
139	165	transmembrane
166	189	non-cytoplasmic
190	210	transmembrane
211	248	cytoplasmic
249	275	transmembrane
276	294	non-cytoplasmic
295	317	transmembrane
318	343	cytoplasmic

Input:
>8500162
MAAMLRRMARKLAWMLFVFWGITIISFWVIHLAPGSPTDMQTTMNPLAGAETRKRLEALY
GLDKPLHVQYVQWLGRLSRLDFGNSMSSDPRPVWDKIKERLPLTVGMNVASLVLTMLCAI
PIGVASAHWQGRLFDRAMTVLVFIGFAMPGFWLALLLMLLFGIHLQWLPLSGLTSLDHAA
MSPMGKAWDIMAHLAMPIFIYTFGSLAGLSRFMRASMLEVLRQDYILTARAKGLPVRTVI
FRHALRNALLPVITILGLSLPGLIGGSVIIESIFALPGLGQLFYQAVMARDYPLIMGNLV
LGAVLTLVGNLLADLCYGLADPRIRLTGGSGGDGAGNGDGGNA

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server