Table:
begin	end	state
1	22	cytoplasmic
23	46	transmembrane
47	80	non-cytoplasmic
81	103	transmembrane
104	114	cytoplasmic
115	135	transmembrane
136	163	non-cytoplasmic
164	189	transmembrane
190	209	cytoplasmic
210	235	transmembrane
236	270	non-cytoplasmic
271	293	transmembrane
294	302	cytoplasmic

Input:
>AO356_05190
MSSVAVFSKASPFDALQRWLPKLVLAPSMFIVLVGFYGYILWTFVLSFTTSTFLPNYKWA
GLAQYARLMDNDRWWVASKNLVLFGGMFIGITLVIGVLLAVFLDQRIRREGFIRTIYLYP
MALSMIVTGTAWKWLLNPGMGLDKLLRDWGWEGFRLDWLIDPDRVVYCLVIAAVWQASGF
IMAMFLAGLRGVDQSIIRAAQIDGASMPRIYWKVVLPSLRPVFFSAVMILAHIAIKSFDL
VAAMTAGGPGYSSDLPAMFMYSFTFSRGQMGMGSASAILMLGAILAIIVPYLYSELRTKR
HD

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server