Table:
begin	end	state
1	128	cytoplasmic
129	146	transmembrane
147	162	non-cytoplasmic
163	177	transmembrane
178	181	non-cytoplasmic
182	238	cytoplasmic
239	365	non-cytoplasmic
366	391	transmembrane
392	429	cytoplasmic

Input:
>AO356_19670
MADKKAQLIIEGAAPVELPILTGTVGPDVIDVRGLTATGRFTFDPGFMSTASCESKITYI
DGDNGILLHRGYPIEQLAEKSDYLETCYLLLNGELPTAEQKAQFVSTVKNHTMVHEQLKT
FFNGFRRDAHPMAVMCGVVGALSAFYHDSLDINNPQHREISAIRLVAKMPTLAAMVYKYS
MGQPMMYPRNDLTYAENFLHMMFNTPCEIKPISPVLAKAMDRIFILHADHEQNASTSTVR
LAGSSGANPFACIAAGIAALWGPAHGGANEAVLTMLDEIGDVSNIDKFIAKAKDKNDPFK
LMGFGHRVYKNRDPRATVMKQTCDEVLKELGIKNDPQLELAMRLEEIALTDPYFIERSLY
PNVDFYSGIILKAIGIPTSMFTVIFALARTVGWISHWKEMLSSPYKIGRPRQLYTGYESR
DITQLEDRK

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server