Table:
begin	end	state
1	24	signal peptide
25	578	non-cytoplasmic
579	598	transmembrane
599	609	cytoplasmic
610	631	transmembrane
632	800	non-cytoplasmic

Input:
>Ac3H11_1914
MSRFQVKKVAVLGAGVMGAQIAAHLVNVKVPVVLFDLPAKEGPKNGIVTKAVEGLKKLKP
SPLGLADDAALIQQANYEEHMHLLKECDLVIEAIAERMDWKLDLYTKIAPHVAKHAILAS
NTSGLSITKLSEVLPESIKPRFCGIHFFNPPRYMTLVELINTPTTQPEVLDQLEAFVTSG
LGKGVVRAHDTPNFVANRVGIAGMLATMKEVENFGLTYDVVDDLTGKKLGRASSGTFRTA
DVVGLDTMAHVIKTLQDNLSIETDPFYESFGTPAVLKKLLELGNLGQKAKAGFFKKVGRD
VMRFELDSEEYVPAGQKADEVYSRMLKKPAAERLRLLRNAEGAPGQFLWAILRNSFHYAA
VHLGTIADNARDVDQAMRWGFGMKQGPFELWQEAGWLEVAKMIQEDIDAGKALCKAPLPE
WVFKGPVAEAAGVHTAQGSWSASQNKFVPRRQLPVYERQIFPEALLGETSLPDWRTAGTT
IAESKALRTWTLDGQVLIASIKNKMHAISPEVMEALMEALELAESEYQGMVIWSGDAPFS
VGADLEATMPAFMVGGADAVESIEQELQNLMMRIRYAQVPVVAAIHGMALGGGCELAVYS
AKRVAHMESYIGLVEVGVGLVPGAGGLTYIARRAAENMAASTSKDILPFLTEGFTAAAMA
KVGTSALESRKLGFLLDGDVIVPHKDELLFVAINEAKSMAASGWCAPHKRLFPVAGRSGL
ATIKAQLVNMRDGGFISAYDFKIGAMIAEVVCGGDVDAGSMVSEEYLLTLERKVFCHLIA
QPKTHERILGMLSTGKPVRN

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server