Table:
begin	end	state
1	27	cytoplasmic
28	49	transmembrane
50	56	non-cytoplasmic
57	83	transmembrane
84	89	cytoplasmic
90	109	transmembrane
110	114	non-cytoplasmic
115	137	transmembrane
138	155	cytoplasmic
156	178	transmembrane
179	189	non-cytoplasmic
190	209	transmembrane
210	239	cytoplasmic
240	261	transmembrane
262	270	non-cytoplasmic
271	293	transmembrane
294	304	cytoplasmic
305	325	transmembrane
326	331	non-cytoplasmic
332	351	transmembrane
352	369	cytoplasmic
370	392	transmembrane
393	399	non-cytoplasmic
400	418	transmembrane
419	425	cytoplasmic

Input:
>BPHYT_RS03430
MNATTAASLAGSRQNSWRAVIAASIGNALEWFDLVVYGFFAVIIAKLFFPAGNDTVSLLL
TLGTFGVSFFMRPLGAIVIGAYADRAGRKAALTLSILLMMGGTLIIAILPTYQSIGLAAP
VILVLARLMQGFSAGGEFGSATAFLAEHVPGRRGFFASWQVASQGLTTLLAAGFGVLLTG
KLSPEQMASWGWRVPFFFGLLIGPVAWYIRTKLDETPEFLAAETTETPLRDTFTSQKLRL
LIAIGVVVLGTVSTYLVLFMPTFGVKQLGLAPSVAFSAIALTGLIQMVFSPLVGHLSDRH
GRTTIMLSSALLLLVLIYPAFVYLVAHPTFGTLIAMQIVFGFLMTGYFAALPGLLSEMFP
VQTRTTGMSLAYNIAVTIFGGFGPFIIAWLISVTGSKAAPSYYLIFAAIVSLVALTAARR
KLGFR

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server