Table:
begin	end	state
1	19	non-cytoplasmic
20	38	transmembrane
39	51	cytoplasmic
52	74	transmembrane
75	92	non-cytoplasmic
93	110	transmembrane
111	150	cytoplasmic
151	157	non-cytoplasmic
158	178	transmembrane
179	190	non-cytoplasmic
191	216	transmembrane
217	229	cytoplasmic

Input:
>BPHYT_RS05505
MFLQGYGPLLLNGTWQTVKLAVLSLAFAFVLGLLGAAAKLSKNRFSYGVGTVYTTLVRGV
PDLVLMLLLFYSIQIWLNNLTDLLGWDQIDIDPFVAGVAVLGFIYGAYFTETFRGAFLAV
PRGQLEAGAAYGMTGWQVFTRVMFPQMMRFALPGIGNNWQVMVKATALVSIIGLADVVKA
SQDAGKGTLRFFFFTLFAGAIYLVITTVSNFVLMYLEKRYSTGVRKADL

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server