Table:
begin	end	state
1	9	cytoplasmic
10	34	transmembrane
35	39	non-cytoplasmic
40	57	transmembrane
58	63	cytoplasmic
64	80	transmembrane
81	85	non-cytoplasmic
86	107	transmembrane
108	117	cytoplasmic
118	138	transmembrane
139	837	non-cytoplasmic

Input:
>BPHYT_RS08325
MTSQSNSRGVIGVVTLLFTVLTALYLLIGGAWLLSVGGSAYYLITGVALLGVAWLLWRRS
PTALVLYSLVLIGTAIWALMESGPDFWALAPRSGVLVIFGVWLLLLVSWRLVGERKLGVV
SLVVALVAWAGVLVYASFNDPQQVNGTLSASAPASGAGAGSGIDPADWPAYGRTQEGTRY
SPLQQITPENVKDLQVAWTFRTGDMKGPNDPVEITDEVTPIKIGDLLYLCSPHQILFALD
AKTGTLKWKFDPRLKSDPSFQHVTCRGVSYVDLSAGATAAAPATAPASDATATAAAPASD
TATAAAPASDTATATTTAAPAATPASDTTATCTRRIYLPVNDGHLYALDALTGQRCEGFA
NHGDLDLQHAQPVTTAGMYEPTSPSIITSKVIIVAGSVEDNFSNREPSGVIRGFDVRTGE
LLWAFDPGAKDPNHIPGAGEHYTWNSPNSWAPAAYDAKLDIVYLPMGVTTPDIWGGNRTP
EQERYASGLLALNASTGKLAWFYQTAHHDLWDMDQPSQPTLADITGKDGQSVPVVYAPAK
TGNLFVLDRRTGVPVVPAPETPVPQGAAPGDHVSPTQPFSQLTYRPSKKLTDADMWGATM
YDQLVCRVMFHKLRYEGTFTPPSLQGTLVFPGNLGMFEWGGIAVDTDRQIAVANPIALPF
VSRLIPRGPGNPLEPVPGAKGSGTESGIQPQYGVPYGVVINAFLSPFGLPCKQPAWGYIS
AIDLKTNEIVWKKRIGTVRDSSPIPLPFRMGMPMLGGPIVTAGGVAFIGATADNYIRGFD
VNNGKQVWEARLPAGGQATPMSYSINGRQYLVIAAGGHGSFGTKLGDYVIAYALPQQ

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server