Table:
begin	end	state
1	742	non-cytoplasmic

Input:
>BPHYT_RS20300
MSTPPKIIYTLTDEAPALATYSLLPIVKAFTRSSDVIVETRDISLAGRIIAAFPDYLSAE
QKGPDDLAELGGLSTRPEANVIKLPNISASVPQLKAAITELRDQGYKLPAYPDVANTDAE
KDVKARYDKIKGSAVNPVLREGNSDRRAPLSVKNYARKHPHKMGAWSADSKSHVAHMSGG
DFYGSEKSALIGAAGSVKIELTATDGSKTVLKEKTAVQAGEIIDASVLSKNALRSFIEAE
IADAKAKGVLFSVHLKATMMKVSDPIIFGHVVSVFYKDVLTKHADALAQAGFNPNNGIGD
LYARLKDLPAETVAAIEADIKAQYEQRPQLAMVNSDKGITSLHVPSDVIVDASMPAMIRE
SGKMWGADGALHDAKAVIPDRCYAGVYQAVIEDCKKHGAFDPVTMGTVPNVGLMAQAAEE
YGSHDKTFQIPANGVVRVTDAAGTVLIEQQVEAGDIWRMCQTKDAPVQDWVKLAVNRARA
TNTPAVFWLDAARAHDAQIIKKVEQYLKNHDTTGLDIRVMTPVEATKFSIERIRAGKDTI
SVTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMFETGAGGSAPKHVQQLVEEGFL
RWDSLGEFLALAASLEHLSSAYHNPKAQVLAKTLDQATGKFLDNDKSPARKVGGIDNRGS
HFYLALYWAEALAAQTEDAALQAQFAGVAKALAENEAKIVEELAAAQGKPVDIGGYYRPN
VELTSKAMRPSATLNKIVDAIA

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server