Table:
begin	end	state
1	11	cytoplasmic
12	29	transmembrane
30	34	non-cytoplasmic
35	54	transmembrane
55	90	cytoplasmic
91	113	transmembrane
114	119	non-cytoplasmic
120	141	transmembrane
142	161	cytoplasmic
162	185	transmembrane
186	191	non-cytoplasmic
192	211	transmembrane
212	222	cytoplasmic
223	242	transmembrane
243	257	non-cytoplasmic
258	278	transmembrane
279	284	cytoplasmic
285	304	transmembrane
305	325	non-cytoplasmic
326	348	transmembrane
349	364	cytoplasmic
365	387	transmembrane
388	487	non-cytoplasmic
488	508	transmembrane
509	532	cytoplasmic
533	552	transmembrane
553	564	non-cytoplasmic
565	589	transmembrane
590	595	cytoplasmic
596	616	transmembrane
617	663	non-cytoplasmic
664	683	transmembrane
684	716	cytoplasmic

Input:
>BWI76_RS03820
MDTKKLFKHIPWVILGIIGAFCLSVVALRRGEHVSALWIVVASVSVYLVAYRYYSLYIAQ
KVMKLDPTRSTPAVINNDGLNYVPTNRYVLFGHHFAAIAGAGPLVGPVLAAQMGYLPGTL
WLLAGVVLAGAVQDFMVLFISSRRNGASLGEMIKQEMGPVPGSIALFGCFLIMIIILAVL
ALIVVKALAESPWGVFTVCSTVPIALFMGIYMRFLRPGRVGEVSVIGIVLLVASIYFGGI
IAHDPYWGPALTFKDTTITFTLIGYAFISALLPVWLILAPRDYLATFLKIGVIVGLALGI
VILNPDLKMPAVTQYIDGTGPLWKGALFPFLFITIACGAVSGFHALIASGTTPKLLANET
DARFIGYGAMLMESFVAVMALVAASIIEPGLYFAMNTPPAGLGITMPNLHEMGGENAALI
AAQLRDVTAHAAATVSSWGFVISPEQILQTAKDIGEPSVLNRAGGAPTLAVGIAHVFHKI
IPMADMGFWYHFGILFEALFILTALDAGTRAGRFMLQDLLGNFVPFLKKTDSLVAGIIGT
AGCVGLWGYLLYQGVVDPLGGVKSLWPLFGISNQMLAAVALVLGTVVLVKMQRTKYIWVT
VIPAAWLLLCTTWALGLKLFSTNPQMEGFFFMAQQYKEKIAAGGELTAQQIANMNHIVVN
NYTNAGLSILFLVVVYSIIFYGIKTWLNVRNNKVRTDKETPYVPVPEGGVKTSSHH

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server