Table:
begin	end	state
1	14	non-cytoplasmic
15	37	transmembrane
38	48	cytoplasmic
49	71	transmembrane
72	82	non-cytoplasmic
83	104	transmembrane
105	125	cytoplasmic
126	144	transmembrane
145	179	non-cytoplasmic
180	200	transmembrane
201	213	cytoplasmic

Input:
>BWI76_RS07580
MDAISWQLLIEGAWTTLWISAIAIAFGVAIGLLIALVRMLRIPVIDQLLVVYISLARATP
LVTLVLFLFLSLPTVGINLDKNVAAIVALTLNTSAFNAEIWRNAFRTFPREQREAAESVG
MRRWAYFRYIMLPQMWIESLPALVNEMSFLIKGSPAIAVIGVVDLTRVTNRISSVTYEPL
SPILAAGLLYVVIIGLLLKLQGMAERKAKRLAR

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server