Table: begin end state 1 18 cytoplasmic 19 41 transmembrane 42 52 non-cytoplasmic 53 74 transmembrane 75 88 cytoplasmic
Input: >GFF1282 HP15_1252 membrane protein containing probable solute: sodium symporter, small subunit domain MSAGHSYDAEAYWKANLRLIFGSLIVWALVSYGFAILLRPMLAGIPIGGTDLGFWFAQQG SILTFIALIFHYAWRMNKIDEKFGVHEE
Or try the official Phobius web server, which has a different display
Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server