Table:
begin	end	state
1	17	non-cytoplasmic
18	41	transmembrane
42	52	cytoplasmic
53	75	transmembrane
76	94	non-cytoplasmic
95	114	transmembrane
115	154	cytoplasmic
155	156	transmembrane
157	159	non-cytoplasmic
160	182	transmembrane
183	193	cytoplasmic
194	214	transmembrane
215	229	non-cytoplasmic

Input:
>GFF136
MTWEIFIKWLPSFIDGAWLTLQLVGVSVIAGLIVAVPLGIARSSRHLAVRALPYGYIFFF
RGTPLLVQLFLVYYGMAQFDVVRQSALWPYLRDPYWCAIITMTLHTAAYIAEIIRGAIQN
VPHGEIEAARALGMSRSQALLHIILPRATRIGLPAYSNEVILMLKASALASTITLLELTG
MARKIAARTYLHEEMFLTAGLIYLLIAFILMQGFKLLERWLRVDACQGR

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server