Table:
begin	end	state
1	247	non-cytoplasmic
248	267	transmembrane
268	757	cytoplasmic
758	777	transmembrane
778	1175	non-cytoplasmic

Input:
>GFF2557 FitnessBrowser__WCS417:GFF2557
MTDTSLSRDQWLAKTGVLLIIDDVLPPSGPVAKGGTPTVKPKELGLFIAVNDDGLVYAFN
GHVDLGTGIRTSLAQIVAEELDLTMEQVKMVLGDTERVPNQGATIASATLQISAVPLRNA
AAEARRFLLARAAGRLGVSTASLKVDAGVIHAADGRTTTYAELVSGQHDQLRISGDAPLK
PIEDYRLVGKGAARVDIPGKATGELTYVHDMRVPGMLHGRVIRPPYAGLDCGDFVGNSLL
SVDESSIAHIPGIVAVVVIRDFVGVVALREEQAVKAASELQVHWKPWNHGLPDMTDVEQA
IRDNPRVRRTVLDQGNVDEALAGASQRMPRSYLWPYQMHGSIGPSCGVADYSPAGSRVWS
GSQNPHLLRADLAWLLACDEALIDVIRMEAAGCYGRNCADDVCADALLLSRAVGKPVRVQ
LTREQEHLWEPKGTAQLMDVDGGLNADGSIAAYDFETSYPSNGAPTLALLLTGRVEPVAA
MFEMGDRTSIPPYDIDTMRVTINDMAPIVRASWMRGVSALPNTFAHESYIDELAFAAGVD
PVEYRLRYLKDERAIDLVKSTAERANWTPRTAPMQTASDDHLLRGRGFAYARYIHSKFPG
FGAAWAAWVADVAIDKQTGDVSVTRVVIGHDSGMMINPDGVQHQIHGNVIQSTSRVLKER
VTFEESTVASKEWGGYPILTFPEVPKIDVMMMPRQDQPPMGAGESASVPSAAAIANAIYD
ATGIRFRELPITPERVLAALNAGTLGEPAKSPEKRRKWWFGALFATLGAVLATAWPFHAE
IPPIAPPSAGTWSKATLERGRLLAAVGDCAVCHTAPGGATNAGGLAMQTPFGTLYSSNIT
PDVKTGIGAWSYPAFERAMRDGIGRDGRNLYPAFPYTAFRNINEADMQALYAYLMSQVPV
SQAPTPNAMRFPFNIRPLMAGWNALNLRRGEISPQPERSEQWNRGNYLVNGLGHCAACHS
PRNLMGAEKGGKSFLAGGTVDGWEAPALNGLSKASTPWTEDQLFTYLSTGYSDAHGVAAG
PMGPVVSELSKLPKADIRAMAVYLASLKGDAAAEAPAVTAANVPNPDGRRVFEGACKACH
ADGLGPKLFGVSPSFATNTNVHSDQPDNLIKVILQGISKPATQDLGYMPGFKDSLSNSQV
ADLAAYLRAQFAPNAPQWKGLEQKVAHLRANPGTH

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server