Table:
begin	end	state
1	26	cytoplasmic
27	44	transmembrane
45	50	non-cytoplasmic
51	71	transmembrane
72	76	cytoplasmic
77	96	transmembrane
97	102	non-cytoplasmic
103	123	transmembrane
124	129	cytoplasmic
130	148	transmembrane
149	181	non-cytoplasmic
182	203	transmembrane
204	231	cytoplasmic
232	235	non-cytoplasmic
236	259	transmembrane
260	260	non-cytoplasmic
261	270	cytoplasmic
271	301	transmembrane
302	315	non-cytoplasmic
316	335	transmembrane
336	358	cytoplasmic

Input:
>GFF3205
MFYREAGDFKTSYQDDSQTFPIKFDRIRYYVVLALAFLVVPFVVNDYWANAILLPFLIYS
IAAIGLNILVGYCGQVSLGTGGFMAVGAYACYKLMTAFPEMSMFIHVLLAGGITALVCIG
FGLPSLRIKGFYLAVATLAAQFFLVWLFNRVPWFYNYSASGQISAPERDVFGIIITGPNA
PAWATYMFSLIFLAFCALVARNLTRGTVGRSWMAIRDMDIAAEIIGVNPLKAKLSAFGVS
GFFIGVSGALFFSVYLGAVEVGEAFGINKSFLVLFMVIIGGLGSIFGSFAGAAFLVLLPV
VLKVVGVDVLGWPTDIVAHIQLVIVGALIVIFLIAEPHGIAQLWRVAKEKLRLWPFPH

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server