Table:
begin	end	state
1	5	non-cytoplasmic
6	25	transmembrane
26	49	cytoplasmic
50	70	transmembrane
71	75	non-cytoplasmic
76	95	transmembrane
96	115	cytoplasmic
116	137	transmembrane
138	152	non-cytoplasmic
153	170	transmembrane
171	181	cytoplasmic
182	201	transmembrane
202	246	non-cytoplasmic
247	269	transmembrane
270	280	cytoplasmic
281	302	transmembrane
303	392	non-cytoplasmic
393	420	transmembrane
421	440	cytoplasmic
441	459	transmembrane
460	464	non-cytoplasmic
465	487	transmembrane
488	497	cytoplasmic
498	522	transmembrane
523	539	non-cytoplasmic
540	559	transmembrane
560	589	cytoplasmic

Input:
>GFF346 FitnessBrowser__psRCH2:GFF346
MSQYWINMLFVGASFLLYIGIAVWARAGSTKEFYVAGGGVHPVTNGMATAADWMSAASFI
SMAGLIASGGYATSVYLMGWTGGYVLLAMLLAPYLRKFGKFTVPDFIGDRFYSRGARLTA
VVCLILISVTYVIGQMAGAGVAFSRFLEVSNSAGIWIAAAIVFAYAVFGGMKGITYTQVA
QYIVLIIAYTIPAVFIAMQLTGNPIPMFGMFGTHVDSGVPLLDKLDQVVTDLGFAAYTAD
VDNKLNMFLFTLSLMIGTAGLPHVIIRFFTVPKVADARWSAGWTLVFIALLYLTAPAVAS
MARLNLVNTIYPEGPQAEAIRYEDRPEWVQTWERTGLIKWEDKNADGRVQMYNDANAKFT
PTATERGWNGNELTVNNDIIVLANPEIANLPGWVIGLIAAGAIAAALSTAAGLLLAISSA
ISHDLIKTLINPKISEKNEMLAARLSMTAAILLATWLGLNPPGFAAQVVALAFGLAAASL
FPALMMGIFSKRVNSKGAVAGMLVGVISTAVYIFLYLGWFFIPGTASIPNTPDQWWMGIS
PQAFGAVGAMLNFAVAYAVSMATEAPPQEIQDLVESVRTPKGAGVALDH

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server