Table:
begin	end	state
1	25	signal peptide
26	68	non-cytoplasmic
69	87	transmembrane
88	97	cytoplasmic
98	117	transmembrane
118	122	non-cytoplasmic
123	144	transmembrane
145	155	cytoplasmic
156	176	transmembrane
177	181	non-cytoplasmic
182	199	transmembrane
200	206	cytoplasmic
207	227	transmembrane
228	246	non-cytoplasmic
247	275	transmembrane
276	286	cytoplasmic
287	309	transmembrane
310	314	non-cytoplasmic
315	333	transmembrane
334	336	cytoplasmic

Input:
>GFF559
MITRRYALLLAALGAVLLVSCVLSLGFGPARVPVEVVWRIVLYKAFGVGEVNWPAGQEHI
VWLIRVPRMLLGALVGAGLALIGAVLQAVTRNPLADPHLLGVTSGATLGAVIVVLHVGEV
IGLLTLPLAAFIGALLSMLVVLAVASRNGRLESDRLLLCGVAVSFVMMAAANLLLFMGDH
RAASAVMFWMLGGLGLARWELLAVPTATVLLGLGLLLGMARPLNALMAGEQTAVTLGLNA
RNVRLKVFLVASLMTGVLVSISGSIGFVGLMVPHIARRLVGAEHRRLLPVCVLLGSLFLV
WVDVAARTLIAPEDLPIGVATAAIGGLFFIGLMRRR

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server