Table:
begin	end	state
1	245	non-cytoplasmic

Input:
>GFF840
MTSIQTSAEAMNDKIALIDQWCSAARILPVITIEREADILPLADALAAGGLRVLEITLRS
ALGLRAIRLLREQRPELIVGAGTVLDANMLEQAEAAGAQFIVSPGSTPALLEAALQGPLP
LLPGVASASEIMLGYAMGYRRFKLFPAEICGGVAALKALGGPFGDIRFCPTGGVNARNAR
DYLSLANVMCVGGTWMVDAKAVRAGDWAAIESATRQALQALDSAPAAELPRDFDLRAERA
EQREL

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server