Table:
begin	end	state
1	16	non-cytoplasmic
17	43	transmembrane
44	54	cytoplasmic
55	77	transmembrane
78	95	non-cytoplasmic
96	115	transmembrane
116	130	cytoplasmic
131	142	transmembrane
143	162	cytoplasmic
163	182	transmembrane
183	195	cytoplasmic
196	218	transmembrane
219	251	non-cytoplasmic

Input:
>H281DRAFT_05292 FitnessBrowser__Burk376:H281DRAFT_05292
MNFDFDFLLDTVKQLLAAVPTTLGLFFCSLVLGGLLSLVIVTMRVSPHWLPNRFARAYIL
VFRGSPLLIQMFLVYYGMGQFGVIRESFMWPVLREPYMCAVLSLALCTAGYTAEIIRGGL
MAVPVGQIEAGYSIGLSGFGLLRRVIGPIALRQCLPAYSTEAVLLVKSTALASLVTVWEV
TGVAQQIIQQTYRTTEVFICAALIYLFLNFIIVRALGMLETRLSRHLRAAPRQTAPSRPV
SATTEARRAAP

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server