Table:
begin	end	state
1	20	signal peptide
21	29	transmembrane
30	31	signal peptide
32	71	non-cytoplasmic
72	93	transmembrane
94	104	cytoplasmic
105	125	transmembrane
126	153	non-cytoplasmic
154	177	transmembrane
178	204	cytoplasmic
205	224	transmembrane
225	259	non-cytoplasmic
260	281	transmembrane
282	291	cytoplasmic

Input:
>HSERO_RS15495
MKRLPSSVLPWLLLSPAMVLLIAFTHYPALATLWHSFFSTPKGVRPSVFVGLENYRLMAD
DPVFWQALCNNLWFALGTIPLAIALAILMALWVNEKLAGRGVLRLAYFTPTVLPMIAVAN
IWLFFYTPQYGLLEQITGALGLPSHNWLGNPQTVLGALMVVAVWKEAGFFMIFYLAALQQ
ISPVLAEAAALEGASRWQYFWRVQFPLLMPTTLFVLINALINAFRLVDHIVVMTKGGPDN
ASSLLLYYIYEVGFAFWDSSYAAALTVVLLALLGLIALVKFRVLDRRTHYQ

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server