Table:
begin	end	state
1	25	signal peptide
26	306	non-cytoplasmic

Input:
>PP_1071
MMRIVRQLLGAAIAAAVIASPAMAEELTGTLKKIKESGTITLGHRDSSIPFSYLAGKPEP
VGYSHDIQLAVVDALKKQLGTDIKVRYNLVTSQTRIPLVQNGTVDLECGSTTNNVERQQQ
VGFSVGIFEVGTRLLTKVKDGQPAYKDFPDLAGKNVVTTAGTTSERILKAMNADKQMKMN
VISAKDHGEAFNMLESGRAVAFMMDDALLAGEMAKARKPADWVITGTPQSYEIYGCMVRK
DDAAFKKAVDDAIVAYFKSGEVNKSYEKWFMQPIPPKGLNLNFQMSEELKKLIAEPTDKA
ADEKKS

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server