Table:
begin	end	state
1	247	non-cytoplasmic

Input:
>Pf1N1B4_451
MSLQGKVALVTGASRGIGQAIALELGRQGAVVIGTATSASGAERIAATLKENGIQGTGLE
LNVTSDESVAAVLASIQEQFGAPAILVNNAGITRDNLMMRMKDDEWHDVVDTNLNSLFRL
SKGVLRGMTKARWGRIISIGSVVGAMGNAGQVNYAAAKAGLEGFSRALAREVGSRSITVN
SVAPGFIDTDMTRELPEAQREALQTQIPLGRLGQAQEIASVVAFLASDGAAYVTGATIPV
NGGMYMS

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server