Table:
begin	end	state
1	15	non-cytoplasmic
16	42	transmembrane
43	54	cytoplasmic
55	143	transmembrane
144	164	non-cytoplasmic
165	187	transmembrane
188	216	cytoplasmic
217	236	transmembrane
237	247	non-cytoplasmic
248	266	transmembrane
267	272	cytoplasmic
273	294	transmembrane
295	299	non-cytoplasmic
300	316	transmembrane
317	325	cytoplasmic

Input:
>PfGW456L13_3910
MNTASYAGKRSGNFYGLGTYLGLAGALLAMIVLFSVLSSHFLSYDTFSTLANQIPDLMVL
AVGMTFVLIIGGIDLSVGSVLALAASTVSVAILGWGWGVLPAALLGMAVAALAGTITGSI
TVAWRIPSFIVSLGVLEMARGVAYQMTGSRTAYIGDAFAWLSNPIAFGISPSFIIALLII
FVAQAVLTRTVFGRYLIGIGTNEEAVRLAGINPKPYKVLVFSLMGLLAGVAALFQISRLE
AADPNAGSGLELQVIAAVVIGGTSLMGGRGSVISTFFGVLIISVLAAGLAQIGATEPTKR
IITGAVIVVAVVLDTYRSQRASRRT

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server