Table:
begin	end	state
1	91	cytoplasmic
92	93	non-cytoplasmic
94	113	transmembrane
114	149	non-cytoplasmic
150	256	cytoplasmic

Input:
>RR42_RS18255
MLLAWHGQVAVITLNRPDKLNSFTREMHAVLQQALDHVEAGGARALLLTGAGRGFCAGQD
LADLDFTPGAMTDLGELIDVWFNRLIRRLQKLPLPVIAAVNGTAAGAGANLALACDMVLA
ARSASFIQAFVKIGLVPDSGGTWLLPKRIGMARAMGLAMTGDKLSADEAEKWGLIWEAMD
DPLLPEQALALATHLAAQPTRALAAIKQAMYAGASQGLDAQLDLERDLQRELGASPDYAE
GVNAFLEKRAPRFTGR

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server