Table:
begin	end	state
1	16	signal peptide
17	295	non-cytoplasmic

Input:
>Synpcc7942_2145
MASTLRVALAQLAFSDQPVIDRDRVTAAIREAAAAGAELIVLPEIHGGYYFCQTEDPAQF
DRAESIPGPSTDYYSAIARELSVVLILSLFERRAAGLYHNTAVVIERDGTIAGRYRKMHI
PDDPAYYEKFYFTPGDLGFEPIQTSVGKLGVLVCWDQWYPEAARLMALAGAELLIYPTAI
GWDPQDVPEEQQRQLEAWQTVQRGHAIANGIPVLSVNRVGFEPSPDPAAAGSQFWGSSFI
AGPQGEWLAKAGDREPELLIADLDRDRSEQVRRIWPFLRDRRIDAYGDLVRRYRD

Or try the official Phobius web server, which has a different display

Reference: Advantages of combined transmembrane topology and signal peptide prediction - the Phobius web server